PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_6566FA47B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 218aa    MW: 22793.6 Da    PI: 6.1575
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_6566FA47B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB43.11e-131111812696
                  NF-YB  26 kiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                             + kda     e +  fi ++++ a+d c+  kr+tin++d++ al ++ f ++vepl++ l+++r  +++
  Traes_4AL_6566FA47B.1 111 IVNKDAMAAFAESARIFIHYLSATANDVCKDGKRQTINAEDVFKALDEIEFPEFVEPLRTALEEFRSRNAA 181
                            478999999*********************************************************87665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.3E-3277211IPR009072Histone-fold
SuperFamilySSF471131.19E-2581213IPR009072Histone-fold
PfamPF008086.2E-8112156IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MAGEAKEPEA AAQGEGSKPK TKAKKPKAAA AAAEEGEGAK ANKAKKPKPA AAAAEEGEGS  60
KAKKPAAASV PAMAEAEVEE LPKAIVRRLV KDKLARAASG GEGAEGGAEV IVNKDAMAAF  120
AESARIFIHY LSATANDVCK DGKRQTINAE DVFKALDEIE FPEFVEPLRT ALEEFRSRNA  180
ARKPASGKKQ SEKKRKLDKE AVPEEQNGAA DEANAGED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3710680.0AK371068.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2124A02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238535.12e-76PREDICTED: DNA polymerase epsilon subunit 3-like
TrEMBLW5DPT01e-147W5DPT0_WHEAT; Uncharacterized protein
STRINGBRADI4G38527.15e-76(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104143744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27470.13e-32nuclear factor Y, subunit B11
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]